DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and CG13377

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:209 Identity:50/209 - (23%)
Similarity:89/209 - (42%) Gaps:34/209 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPREL---------------Q 55
            :::.::|.|...:|......:...|.||.      |.:||.::|||.:|               .
  Fly    45 SRVVLITSADTALGLQLCTHLANKGYRVF------AGMKEAQDSLPAKLLCGWMKIREYSEEPIA 103

  Fly    56 ANFIPRRCDVSKEDQVQSSFDWIEREL----EGADVLLNNAGITRETELVTPSNTQKLKEVIDTN 116
            ...||.|.||::||.::.:...|...|    .|...::|.:|.....: |...|.|:.:.::.||
  Fly   104 GTIIPMRLDVTREDVLREATVIIGANLNADERGIAAVINTSGSVFRGQ-VESQNVQQWEHMLRTN 167

  Fly   117 VMGVIWCTREAFNNMKRRGGEGHVLIINSIA-GHQVLNFIDVLPSFNIYPATKFAITAITETYRQ 180
            ::|.:...: ||... .|...|.:|.:..:: |....|..|.|.:||   |::.|:....|..|:
  Fly   168 ILGTLRVAK-AFVCF-LRPTRGRLLYLGGVSGGGNARNEGDGLVAFN---ASRVAVDKCAEELRK 227

  Fly   181 EFQLHSNKIRVTGI 194
            |  ||...:.|..:
  Fly   228 E--LHPYGVSVVAL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 50/209 (24%)
NADB_Rossmann 1..247 CDD:304358 50/209 (24%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 50/208 (24%)
NADB_Rossmann 46..>237 CDD:304358 49/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.