DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and Dhrs7

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001258323.1 Gene:Dhrs7 / 299135 RGDID:1565002 Length:338 Species:Rattus norvegicus


Alignment Length:274 Identity:63/274 - (22%)
Similarity:110/274 - (40%) Gaps:84/274 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WQNK---------LAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFI 59
            ||.:         :..:||||.|||...|..:...|:.:|..|||..:|:.::            
  Rat    39 WQGRRPEWELTDMVVWITGASSGIGEELAFQLSKLGVCLVLSARRGQELERVK------------ 91

  Fly    60 PRRC----------------DVSKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQK 108
             |||                |::.....:::...:.:|....|:|:||.|.::.: ||..:|.:.
  Rat    92 -RRCLENGNLKEKDILVLPLDLTDTSSHEAATKAVLQEFGKIDILVNNGGRSQRS-LVLETNLEV 154

  Fly   109 LKEVIDTNVMGVIWCTREAFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNI---YPATKFA 170
            .||:::.|.:|.:..|:....:|..| .:|.::.:||:||         :.|.::   |.|:|.|
  Rat   155 FKELMNLNYLGTVSLTKCVLPHMVER-KQGKIVTVNSLAG---------IASVSLSSGYCASKHA 209

  Fly   171 ITAITETYRQEFQLHSNKIRVTGICPGAVNTNIFPEEIHFYVKDMARLEPANIADAVMYALRTPP 235
            :......      |||.    .|..||....|::|..:.              ::.|..||    
  Rat   210 LRGFFNA------LHSE----LGKYPGITLCNVYPGPVQ--------------SNVVKNAL---- 246

  Fly   236 HVQVHEITIKPMGE 249
               ..|:| |||.|
  Rat   247 ---TEELT-KPMRE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 63/274 (23%)
NADB_Rossmann 1..247 CDD:304358 60/270 (22%)
Dhrs7NP_001258323.1 11beta-HSD1_like_SDR_c 48..308 CDD:187593 61/265 (23%)
adh_short 52..250 CDD:278532 55/252 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.