DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and Dhrs7l1

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001013116.1 Gene:Dhrs7l1 / 299131 RGDID:1308036 Length:324 Species:Rattus norvegicus


Alignment Length:213 Identity:57/213 - (26%)
Similarity:96/213 - (45%) Gaps:34/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRES--------------LPRELQA 56
            :|:..:||||.|||...|..:...|:.:|..|||..:|:.::..              ||.:|  
  Rat    49 DKVVWITGASSGIGEELAFQLSKLGVCLVLSARRGQELERVKRRCLENGNLKEKDILVLPLDL-- 111

  Fly    57 NFIPRRCDVSKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVI 121
                  .|.|..|....:   :.:|....|:|:||.|:. ...||..:|....|.:|:.|.:|.:
  Rat   112 ------ADTSSHDIATKT---VLQEFGRIDILVNNGGVA-HASLVENTNMDIFKVLIEVNYLGTV 166

  Fly   122 WCTREAFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHS 186
            ..|:....:|..| .:|.::::.|:.|      |...|..:.|.|:|.|:....:..|.|...:.
  Rat   167 SLTKCVLPHMMER-NQGKIVVMKSLVG------IVPRPLCSGYAASKLALRGFFDVLRTELFDYP 224

  Fly   187 NKIRVTGICPGAVNTNIF 204
            . |.::.||||.|::|||
  Rat   225 G-ITLSMICPGPVHSNIF 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 57/213 (27%)
NADB_Rossmann 1..247 CDD:304358 57/213 (27%)
Dhrs7l1NP_001013116.1 11beta-HSD1_like_SDR_c 47..305 CDD:187593 57/213 (27%)
adh_short 50..247 CDD:278532 57/212 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.