DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and Dhrs7c

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001258527.1 Gene:Dhrs7c / 287411 RGDID:1306989 Length:311 Species:Rattus norvegicus


Alignment Length:254 Identity:63/254 - (24%)
Similarity:112/254 - (44%) Gaps:49/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLP--RELQANFIPR------ 61
            |||:.|:|.|..|:|..|||.....|.|:|...:....|:.|..:|.  .:....|.|:      
  Rat    36 QNKVVVITDALSGLGKECARVFNAGGARLVLCGKNWEGLESLYAALTSVADPSKTFTPKLVLLDL 100

  Fly    62 ---RC--DVSKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKL---KEVIDTNVM 118
               .|  ||:||  |...:..:       |:|:|||.:    ::..|::...|   |:::|.|..
  Rat   101 SDISCVEDVAKE--VLDCYGCV-------DILINNASV----KVKGPAHKISLELDKKIMDANYF 152

  Fly   119 GVIWCTREAFNNM-KRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEF 182
            |.|..|:....|| .||.|:  ::::|:|..    .|  .:|....|.|:|.|:....:..|.|.
  Rat   153 GPITFTKVLLPNMISRRTGQ--IVLVNNIQA----KF--GIPFRTAYAASKHAVMGFFDCLRAEV 209

  Fly   183 QLHSNKIRVTGICPGAVNT-NIFPEE-------IHFYVKDMA-RLEPANIADAVMYALR 232
            :.:.  :.|:.:.|..:.: ..:||:       ..|:.:.:. .:.|..:|:.||..:|
  Rat   210 EEYD--VVVSTVSPTFIRSYQAYPEQRNWGSSICKFFCRKLTYGVHPVEVAEEVMRTVR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 63/254 (25%)
NADB_Rossmann 1..247 CDD:304358 63/254 (25%)
Dhrs7cNP_001258527.1 11beta-HSD1_like_SDR_c 35..296 CDD:187593 63/254 (25%)
PRK06181 37..293 CDD:235726 62/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.