DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and Dhrs7b

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001008507.1 Gene:Dhrs7b / 287380 RGDID:1311243 Length:325 Species:Rattus norvegicus


Alignment Length:215 Identity:61/215 - (28%)
Similarity:102/215 - (47%) Gaps:37/215 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAK-----LKELRESLPRELQANFIPRRCD 64
            :|.:.|||||:.|:|..|||....||.:|| |..|..|     .:||.:|...:.|.:   :.|.
  Rat    51 RNAVVVVTGATSGLGKECARVFHAAGAKVV-LCGRNVKALEEFTRELADSSSSQGQTH---QPCV 111

  Fly    65 VSKE-----------DQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVM 118
            |:.:           .::...|.::       |:|:|||||:.. ..::.:.....::|::.|..
  Rat   112 VTFDLADPGAIAPAAAEILQCFGYV-------DILINNAGISYR-GAISDTIVDVDRKVMEINYF 168

  Fly   119 GVIWCTREAFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQ 183
            |.:..|:....:|..| ..||::.|:||.|.     |.: |..:.|.|:|.|..|..:..|.|  
  Rat   169 GPVALTKALLPSMVER-KRGHIVAISSIQGK-----ISI-PFRSAYAASKHATQAFFDCLRAE-- 224

  Fly   184 LHSNKIRVTGICPGAVNTNI 203
            :..:.|.||.|.||.::||:
  Rat   225 MKDSDIEVTVISPGYIHTNL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 61/215 (28%)
NADB_Rossmann 1..247 CDD:304358 61/215 (28%)
Dhrs7bNP_001008507.1 11beta-HSD1_like_SDR_c 50..311 CDD:187593 61/215 (28%)
PRK06181 52..321 CDD:235726 61/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.