DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and rdh8a

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_957001.1 Gene:rdh8a / 280648 ZFINID:ZDB-GENE-021115-3 Length:318 Species:Danio rerio


Alignment Length:274 Identity:74/274 - (27%)
Similarity:126/274 - (45%) Gaps:76/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLAVVTGASGGIGAACARAMIGAGLRV-VGLARREAK-------LKELRES-------------- 49
            |:.::||.|.||           |||: |.|||.|.|       :::|::.              
Zfish     8 KVVLITGCSSGI-----------GLRIAVLLARDEQKRYHVIATMRDLKKKDRLVEAAGEVYGQT 61

  Fly    50 ---LPRELQANFIPRRCDVSKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNT---QK 108
               ||.::.::...|:|..|.:|:             ..|||:||||:    .|:.|..:   .:
Zfish    62 LTLLPLDICSDESVRQCVNSVKDR-------------HIDVLINNAGV----GLLGPVESISMDE 109

  Fly   109 LKEVIDTNVMGVIWCTREAFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITA 173
            :|.|.:||..|.:...:|...:||:|.. ||::|::|:.|.|.:.|.||      |.|:||||..
Zfish   110 MKRVFETNFFGTVRMIKEVMPDMKKRQA-GHIIIMSSVMGLQGVVFNDV------YTASKFAIEG 167

  Fly   174 ITETYRQEFQLHSNKIRVTGICPGAVNTNIFPEEIHFYVKDMARLE-PANIADAVMY--ALRTPP 235
            ..|:  ...||....::::.|.||.|:|. |..::   ::::|::| |....|.|.|  .:..|.
Zfish   168 FCES--MAVQLLKFNVKLSLIEPGPVHTE-FETKM---MEEVAKMEYPGADPDTVRYFKDVYVPS 226

  Fly   236 HVQVHEITIKPMGE 249
            .:.:.|    .||:
Zfish   227 SIDIFE----AMGQ 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 74/274 (27%)
NADB_Rossmann 1..247 CDD:304358 72/270 (27%)
rdh8aNP_957001.1 type1_17beta-HSD-like_SDR_c 8..265 CDD:187666 74/274 (27%)
adh_short 8..207 CDD:278532 65/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.