DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and DHRS7B

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011522088.1 Gene:DHRS7B / 25979 HGNCID:24547 Length:334 Species:Homo sapiens


Alignment Length:222 Identity:69/222 - (31%)
Similarity:106/222 - (47%) Gaps:51/222 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDVSKED 69
            :|.:.|:|||:.|:|..||:....||.::|...|....|:|    |.|||.|         |...
Human    98 RNAVVVITGATSGLGKECAKVFYAAGAKLVLCGRNGGALEE----LIRELTA---------SHAT 149

  Fly    70 QVQS------SFDWIERELEGA---------------DVLLNNAGIT-RETELVTPSNTQKLKEV 112
            :||:      :||..:   .||               |:|:|||||: |.|.:.|..:..  |.|
Human   150 KVQTHKPYLVTFDLTD---SGAIVAAAAEILQCFGYVDILVNNAGISYRGTIMDTTVDVD--KRV 209

  Fly   113 IDTNVMGVIWCTREAFNNM-KRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITE 176
            ::||..|.:..|:....:| |||  :||::.|:||.|..      .:|..:.|.|:|.|..|..:
Human   210 METNYFGPVALTKALLPSMIKRR--QGHIVAISSIQGKM------SIPFRSAYAASKHATQAFFD 266

  Fly   177 TYRQEFQLHSNKIRVTGICPGAVNTNI 203
            ..|.|.:.:  :|.||.|.||.::||:
Human   267 CLRAEMEQY--EIEVTVISPGYIHTNL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 69/222 (31%)
NADB_Rossmann 1..247 CDD:304358 69/222 (31%)
DHRS7BXP_011522088.1 11beta-HSD1_like_SDR_c 97..>304 CDD:187593 69/222 (31%)
adh_short 101..294 CDD:278532 68/219 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.