DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and SPAC521.03

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_593098.1 Gene:SPAC521.03 / 2543461 PomBaseID:SPAC521.03 Length:259 Species:Schizosaccharomyces pombe


Alignment Length:255 Identity:69/255 - (27%)
Similarity:124/255 - (48%) Gaps:19/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWQNKLAVVTGASGGIGAACARAMIG-AGLRVVGLARREAKLKELRESLPRELQANFIPRRCD 64
            |.|...|..::||||.|||.:.|..:.. |.::::..|||.:.::|:.:.|..:.:.:.:|.:.|
pombe     1 MSRLDGKTILITGASSGIGKSTAFEIAKVAKVKLILAARRFSTVEEIAKELESKYEVSVLPLKLD 65

  Fly    65 VSKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAFN 129
            ||....:....:.:.:|....|||:||||:...|:.|...|......:|.|||:|::..||....
pombe    66 VSDLKSIPGVIESLPKEFADIDVLINNAGLALGTDKVIDLNIDDAVTMITTNVLGMMAMTRAVLP 130

  Fly   130 NMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVTGI 194
            ....: .:|.:|.:.||||.:  :::    ..::|.:||.|:...|...|:|  ....:||:..:
pombe   131 IFYSK-NKGDILNVGSIAGRE--SYV----GGSVYCSTKSALAQFTSALRKE--TIDTRIRIMEV 186

  Fly   195 CPGAVNTNIFPEEIH--------FYVKDMARLEPANIADAVMYALRTPPHVQVHEITIKP 246
            .||.|.|.......|        .| |:...|.|.:||:.:::||....:|.:.:..:.|
pombe   187 DPGLVETEFSVVRFHGDKQKADNVY-KNSEPLTPEDIAEVILFALTRRENVVIADTLVFP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 69/255 (27%)
NADB_Rossmann 1..247 CDD:304358 69/255 (27%)
SPAC521.03NP_593098.1 YdfG 1..249 CDD:226674 69/255 (27%)
SDR_c5 7..256 CDD:187604 67/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100320
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.700

Return to query results.
Submit another query.