DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and ayr1

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_594548.1 Gene:ayr1 / 2541489 PomBaseID:SPAC23D3.11 Length:296 Species:Schizosaccharomyces pombe


Alignment Length:236 Identity:64/236 - (27%)
Similarity:102/236 - (43%) Gaps:44/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLAVVTGAS-GGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDVSKEDQ 70
            |..::||.| ||||.|.|......|.:|:..||:..::..|       .:|.....:.||:.||.
pombe     5 KFVLITGCSEGGIGNALALKFHQEGFQVLATARQVERMDNL-------TKAGLQTLKLDVTDEDS 62

  Fly    71 VQSSFDWIERELE-----GADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAFNN 130
            |:.    :|:|:.     ....|:||||.......: ..:.:.:.:|:|.|..|||...: ||.:
pombe    63 VRE----VEQEVRKFTNGSLHYLINNAGAPCSAPAI-DLDIEDVSKVMDVNFYGVIRMNK-AFQH 121

  Fly   131 MKRRGGEGHVLIINSIAGHQVLNFIDVLP-SFN-IYPATKFAITAITETYRQEFQLHSNKIRVTG 193
            ...| .:|.::.:||:        :..:| :|| .|.|:|.|:.|.:.|.|  .:|....::||.
pombe   122 QLIR-AKGTIVNVNSL--------VSYVPFAFNAAYNASKAALLAYSNTLR--IELAPFGVQVTS 175

  Fly   194 ICPGAVNTNI------------FPEEIHFYVKDMARLEPAN 222
            |..|.|.|.|            .||...:|......||..|
pombe   176 IMTGGVQTKIQSKPLGTMTEAAIPENSIYYPYRKLILENRN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 64/236 (27%)
NADB_Rossmann 1..247 CDD:304358 64/236 (27%)
ayr1NP_594548.1 17beta-HSD-like_SDR_c 5..261 CDD:187632 64/236 (27%)
adh_short 5..183 CDD:278532 56/201 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.