DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and SPCC162.03

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_588241.1 Gene:SPCC162.03 / 2539382 PomBaseID:SPCC162.03 Length:292 Species:Schizosaccharomyces pombe


Alignment Length:201 Identity:54/201 - (26%)
Similarity:98/201 - (48%) Gaps:34/201 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASGGIGAACARAMIGAGLRVVGLAR-------REAKLKELRESLPRELQANFIPRRCDVSK 67
            ::||:|.|:|.|..:..:..|..|:..:|       ..:||.:|               :.||:.
pombe     9 LITGSSKGLGYALVKVGLAQGYNVIACSRAPDTITIEHSKLLKL---------------KLDVTD 58

  Fly    68 EDQVQSSFDWIERELEGADVLLNNA--GITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAFNN 130
            ...|:::|...:|.....|:::|||  |:..|.|   ..|.:::...::.|..||.:.|:||.|.
pombe    59 VKSVETAFKDAKRRFGNVDIVINNAGYGLVGEFE---SYNIEEMHRQMNVNFWGVAYITKEALNL 120

  Fly   131 MKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVTGIC 195
            |:..|..|.:|.|:|:||:.      ..|..::|.|:|||:..:::|..:|...:.| |.:|.:.
pombe   121 MRESGKGGRILQISSVAGYY------PSPCLSMYNASKFAVEGLSQTIMRELDPNWN-IAITIVQ 178

  Fly   196 PGAVNT 201
            ||.:.|
pombe   179 PGGMQT 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 54/201 (27%)
NADB_Rossmann 1..247 CDD:304358 54/201 (27%)
SPCC162.03NP_588241.1 17beta-HSD-like_SDR_c 7..248 CDD:187632 54/201 (27%)
PRK08263 9..257 CDD:181334 54/201 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I1885
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm47108
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.