DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and Hsd17b1

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_036983.1 Gene:Hsd17b1 / 25322 RGDID:2836 Length:344 Species:Rattus norvegicus


Alignment Length:270 Identity:68/270 - (25%)
Similarity:108/270 - (40%) Gaps:70/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAVVTGASGGIGAACARAMIGAGLRVVGLA-------RREAKLKELRESLP--RELQANFIP--- 60
            :.::||.|.|||...|          |.||       :..|.|::|:...|  ...:|...|   
  Rat     5 VVLITGCSSGIGLHLA----------VRLASDRSQSFKVYATLRDLKSQGPLLEAARAQGCPPGS 59

  Fly    61 ---RRCDVSKEDQVQSSFDWIERELEG-ADVLLNNAGITRETELVTPSNTQKLK---EVIDTNVM 118
               ...||...:.|.::...:   .|| .|||:.|||    ..|..|....:|.   .|:|.||:
  Rat    60 LEILELDVRDSESVAAARACV---TEGRVDVLVCNAG----RGLFGPLEAHELNAVGAVLDVNVL 117

  Fly   119 GVIWCTREAFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQ 183
            |.|...:....:|||| ..|.||:..|:.|      :..||...:|.|:|||:..:.|:......
  Rat   118 GTIRMLQAFLPDMKRR-HSGRVLVTASVGG------LMGLPFHEVYCASKFALEGLCESLAILLP 175

  Fly   184 LHSNKIRVTGICPGAVNTNIFPEEI--------------------HF---YVKDMARL-EPANIA 224
            |..  :.|:.|..|||:| .|.|::                    |:   |.:.::.. :|..:.
  Rat   176 LFG--VHVSLIECGAVHT-AFHEKLEGGPGGALERADAQTRHLFAHYQRGYEQALSEAQDPEEVT 237

  Fly   225 DAVMYALRTP 234
            :..:.|:|.|
  Rat   238 ELFLTAMRAP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 68/270 (25%)
NADB_Rossmann 1..247 CDD:304358 68/270 (25%)
Hsd17b1NP_036983.1 NADB_Rossmann 4..260 CDD:419666 68/270 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.