DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and Dhrs7b

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_663403.1 Gene:Dhrs7b / 216820 MGIID:2384931 Length:323 Species:Mus musculus


Alignment Length:204 Identity:61/204 - (29%)
Similarity:101/204 - (49%) Gaps:17/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQAN----FIPRRCDV 65
            :|.:.|||||:.|:|..||:....||.::|...|....|:||...|....|..    |:. ..|:
Mouse    51 RNAVVVVTGATSGLGRECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQGQTHQPFVV-TFDL 114

  Fly    66 SKEDQVQSSFDWIERELEGADVLLNNAGIT-RETELVTPSNTQKLKEVIDTNVMGVIWCTREAFN 129
            :....:.::...|.:.....|||:|||||: |.|  ::.:.....::|::.|..|.:..|:....
Mouse   115 ADPGTIAAAAAEILQCFGYVDVLINNAGISYRGT--ISDTIVDVDRKVMEINYFGPVALTKALLP 177

  Fly   130 NMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVTGI 194
            :|..| .:||::.|:||.|.     |.: |..:.|.|:|.|..|..:..|.|  :....|:||.|
Mouse   178 SMVER-KQGHIVAISSIQGK-----ISI-PFRSAYSASKHATQAFFDCLRAE--MEEANIKVTVI 233

  Fly   195 CPGAVNTNI 203
            .||.::||:
Mouse   234 SPGYIHTNL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 61/204 (30%)
NADB_Rossmann 1..247 CDD:304358 61/204 (30%)
Dhrs7bNP_663403.1 11beta-HSD1_like_SDR_c 50..309 CDD:187593 61/204 (30%)
PRK06181 52..319 CDD:235726 61/203 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.