DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and R05D8.9

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_503753.1 Gene:R05D8.9 / 187609 WormBaseID:WBGene00019886 Length:281 Species:Caenorhabditis elegans


Alignment Length:260 Identity:59/260 - (22%)
Similarity:106/260 - (40%) Gaps:50/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWQNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPR---- 61
            :.|:..|:|:|||:|.|||.|.|......|.:|....|...:|:|.|:    |:..:.:|.    
 Worm     2 LSRFSGKVALVTGSSNGIGRAAAVLFAKDGAKVTVTGRNAERLEETRQ----EILKSGVPESHVL 62

  Fly    62 ------RCDVSKEDQVQSSFDWIERELEGADVLLNNAGIT---RETELVTPSNTQKLKEVIDTNV 117
                  ..:..:::.|.|:.....|    .|:|:||||..   .:..:....:.....:::..|:
 Worm    63 SVATDLAAEKGQDELVNSTIQKFGR----LDILVNNAGAAFNDDQGRVGVDQDVSVYDKIMQINM 123

  Fly   118 MGVIWCTREAFNNMKRRGGEGHVLIINSIAG--HQVLNFIDVLPSFNIYPATKFAITAITETYRQ 180
            ..|:..|::|..::.:..||  ::.::||||  |       ..|....|..:|.|:...|..  .
 Worm   124 RSVVTLTQKAKEHLVKAKGE--IVNVSSIAGTAH-------AQPGVMYYAMSKSALDQFTRC--A 177

  Fly   181 EFQLHSNKIRVTGICPGAVNTNI----------FPEEIHFY------VKDMARLEPANIADAVMY 229
            ...|....:||..:.||.|.|..          |.|.:.|.      :...|..:|.:||:.:.:
 Worm   178 AIDLIQYGVRVNSVSPGGVTTGFGEAMGMPSGAFEEMMKFMESRKECIPSGAVAKPIDIANIIAF 242

  Fly   230  229
             Worm   243  242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 59/260 (23%)
NADB_Rossmann 1..247 CDD:304358 59/260 (23%)
R05D8.9NP_503753.1 fabG 4..266 CDD:235975 59/258 (23%)
NADB_Rossmann 5..266 CDD:304358 58/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D460854at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.