DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and F20G2.1

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_506406.1 Gene:F20G2.1 / 184742 WormBaseID:WBGene00008985 Length:249 Species:Caenorhabditis elegans


Alignment Length:215 Identity:54/215 - (25%)
Similarity:100/215 - (46%) Gaps:28/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLAVVTGASGGIGAACARAMI-GAGLR-VVGLARREAKLKELRESLPRELQANFIPRRCDVSKED 69
            |..::|||:.|||....:..| ...:: ::|..|..:...||...  ::.:.:.:  :.|:..:|
 Worm     4 KSILITGANRGIGLGLLKQFIKNKDVQIIIGTCRDPSNATELNSI--KDTRVHIL--QLDIDCDD 64

  Fly    70 QVQSSFDWIEREL--EGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAFNNMK 132
            .::.....:|:.:  :|..||:|||||....::....:...|...::||.:..:..|:|....:|
 Worm    65 SIRKLGAEVEKLVGEDGLTVLINNAGIFVPYDIDGEKSRSTLIRQLETNTISTVLITQELLPLLK 129

  Fly   133 RRG----GEGH------VLIINSIAGHQVLNFIDVLPSFNI----YPATKFAITAITETYRQEFQ 183
            |..    |||:      ::.|:|.||.  :..||.  |:||    |..:|.|:.:..::.  ...
 Worm   130 RAAAKNRGEGYSINRSAIINISSTAGS--ITKIDA--SYNIPLVAYRMSKSALNSFGKSC--SVD 188

  Fly   184 LHSNKIRVTGICPGAVNTNI 203
            |....|.||..|||.|.|::
 Worm   189 LAKYHILVTTFCPGWVKTDM 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 54/215 (25%)
NADB_Rossmann 1..247 CDD:304358 54/215 (25%)
F20G2.1NP_506406.1 adh_short 4..208 CDD:278532 54/213 (25%)
carb_red_sniffer_like_SDR_c 6..248 CDD:187586 53/213 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155965
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.