Sequence 1: | NP_608991.2 | Gene: | CG9150 / 33856 | FlyBaseID: | FBgn0031775 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510793.2 | Gene: | dhs-30 / 181761 | WormBaseID: | WBGene00000993 | Length: | 311 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 54/206 - (26%) |
---|---|---|---|
Similarity: | 97/206 - (47%) | Gaps: | 35/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 QNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDVSKED 69
Fly 70 QVQSSFD--------WIERELEGADVLLNNAGITRETELVTPSNTQKL-KEVIDTNVMGVIWCTR 125
Fly 126 EAFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIR 190
Fly 191 VTGICPGAVNT 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9150 | NP_608991.2 | YdfG | 1..251 | CDD:226674 | 54/206 (26%) |
NADB_Rossmann | 1..247 | CDD:304358 | 54/206 (26%) | ||
dhs-30 | NP_510793.2 | NADB_Rossmann | 45..291 | CDD:304358 | 54/206 (26%) |
PRK06181 | 47..290 | CDD:235726 | 54/205 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |