DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and dhs-30

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_510793.2 Gene:dhs-30 / 181761 WormBaseID:WBGene00000993 Length:311 Species:Caenorhabditis elegans


Alignment Length:206 Identity:54/206 - (26%)
Similarity:97/206 - (47%) Gaps:35/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDVSKED 69
            :||:.|:||||.|:|.:.|..:...|.:|:.|||...||||:.|    ||:..|     .:::.:
 Worm    46 KNKVVVITGASSGLGKSLAFELYKRGAQVILLARSTEKLKEICE----ELKETF-----PLNQNE 101

  Fly    70 QVQSSFD--------WIERELEGADVLLNNAGITRETELVTPSNTQKL-KEVIDTNVMGVIWCTR 125
            .:...||        |  .|:...|:|:||||::....  ....|.:: ::.::||..|.:..|:
 Worm   102 PIYYYFDITDSEQAPW--AEIPRVDILINNAGMSNRGS--CQDTTMEIHRQAMETNYFGHVHVTQ 162

  Fly   126 EAFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIR 190
            ...:.:   ..:|.:::.:||.|..      .:|....|.|:|.|:....:..|.|   |.| :.
 Worm   163 ALLSKL---SPDGCIVVTSSIQGKV------AIPYRGSYGASKHALQGYFDCLRAE---HKN-LH 214

  Fly   191 VTGICPGAVNT 201
            :..:..|.:||
 Worm   215 ILVVSAGYINT 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 54/206 (26%)
NADB_Rossmann 1..247 CDD:304358 54/206 (26%)
dhs-30NP_510793.2 NADB_Rossmann 45..291 CDD:304358 54/206 (26%)
PRK06181 47..290 CDD:235726 54/205 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.