DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and Hsd11b1

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_006497291.1 Gene:Hsd11b1 / 15483 MGIID:103562 Length:304 Species:Mus musculus


Alignment Length:215 Identity:55/215 - (25%)
Similarity:98/215 - (45%) Gaps:25/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERWQNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQ-----ANFIPR 61
            |..|.|..:|||||.|||...|..:...|..||..||.|..|:::   :.|.|:     |::|..
Mouse    42 EMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKV---VSRCLELGAASAHYIAG 103

  Fly    62 RC-DVSKEDQ--VQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWC 123
            .. |::..:|  |::.     :.:.|.|:|:.| .||:.:..:...:...::.|::.|.:..:..
Mouse   104 TMEDMTFAEQFIVKAG-----KLMGGLDMLILN-HITQTSLSLFHDDIHSVRRVMEVNFLSYVVM 162

  Fly   124 TREAFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNK 188
            :..|...:|:  ..|.:.:|:|:||..      ..|....|.|:|||:.....|.|.|..:....
Mouse   163 STAALPMLKQ--SNGSIAVISSLAGKM------TQPMIAPYSASKFALDGFFSTIRTELYITKVN 219

  Fly   189 IRVTGICPGAVNTNIFPEEI 208
            :.:|....|.::|....:||
Mouse   220 VSITLCVLGLIDTETAMKEI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 55/215 (26%)
NADB_Rossmann 1..247 CDD:304358 55/215 (26%)
Hsd11b1XP_006497291.1 11beta-HSD1_like_SDR_c 44..291 CDD:187593 54/213 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.