DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and Rdh1

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_536684.2 Gene:Rdh1 / 107605 MGIID:1195275 Length:317 Species:Mus musculus


Alignment Length:268 Identity:62/268 - (23%)
Similarity:111/268 - (41%) Gaps:64/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDVSKED 69
            |:|...:||...|.|...||.:...|:||:.....|...:|||......|:...:    ||:|.:
Mouse    28 QDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVIL----DVTKTE 88

  Fly    70 QVQSSFDWIEREL--EGADVLLNNAGITRETELVTPS------NTQKLKEVIDTNVMGVIWCTRE 126
            .:.::..|::..:  .|...|:|||||:      |||      ..|....|:|.|::|:|..|..
Mouse    89 SIVAATQWVKERVGNRGLWGLVNNAGIS------TPSGPNEWMKKQDFARVLDVNLLGMIEVTLS 147

  Fly   127 AFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSF--NIYPATKFAITAITETYRQEFQLHSNKI 189
            ....:::  ..|.|:.::|:.|..         ||  ..|..:|:.:.|.:::.|:|......|:
Mouse   148 MLPLVRK--ARGRVVNVSSVMGRM---------SFFGGGYCISKYGVEAFSDSLRRELSYFGVKV 201

  Fly   190 RVTGICPGAVNT------------------------NIFPEE-IHFYVKDMARLEP------ANI 223
            .:  |.||...|                        .|:.|: :.||:|::..|:.      :.:
Mouse   202 AI--IEPGGFKTCVTSSDRLSSNTKMIWDKASSEVKEIYGEKFLLFYLKNLNELDKRCNKDLSVV 264

  Fly   224 ADAVMYAL 231
            .|.:.:||
Mouse   265 TDCMEHAL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 62/268 (23%)
NADB_Rossmann 1..247 CDD:304358 62/268 (23%)
Rdh1NP_536684.2 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 61/266 (23%)
adh_short 30..211 CDD:278532 51/203 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.