Sequence 1: | NP_608991.2 | Gene: | CG9150 / 33856 | FlyBaseID: | FBgn0031775 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_536684.2 | Gene: | Rdh1 / 107605 | MGIID: | 1195275 | Length: | 317 | Species: | Mus musculus |
Alignment Length: | 268 | Identity: | 62/268 - (23%) |
---|---|---|---|
Similarity: | 111/268 - (41%) | Gaps: | 64/268 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 QNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDVSKED 69
Fly 70 QVQSSFDWIEREL--EGADVLLNNAGITRETELVTPS------NTQKLKEVIDTNVMGVIWCTRE 126
Fly 127 AFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSF--NIYPATKFAITAITETYRQEFQLHSNKI 189
Fly 190 RVTGICPGAVNT------------------------NIFPEE-IHFYVKDMARLEP------ANI 223
Fly 224 ADAVMYAL 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9150 | NP_608991.2 | YdfG | 1..251 | CDD:226674 | 62/268 (23%) |
NADB_Rossmann | 1..247 | CDD:304358 | 62/268 (23%) | ||
Rdh1 | NP_536684.2 | type2_17beta_HSD-like_SDR_c | 30..306 | CDD:187665 | 61/266 (23%) |
adh_short | 30..211 | CDD:278532 | 51/203 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1880 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |