DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and XB1000829

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001096251.1 Gene:XB1000829 / 100124812 XenbaseID:XB-GENE-1000830 Length:323 Species:Xenopus tropicalis


Alignment Length:205 Identity:64/205 - (31%)
Similarity:99/205 - (48%) Gaps:29/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLAVVTGASGGIGAACARAMI---GAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDVSKE 68
            |..::||.|.|||.|.|..:.   ....:|....|..||..:|..:....|......:..||..|
 Frog     4 KTVLITGCSSGIGLAIATKLARDEQKRFKVYATMRNLAKQDDLIAATEGYLGKTMEIKEMDVCCE 68

  Fly    69 DQVQSSFDWI-ERELEGADVLLNNAGITRETELVTPSNTQ---KLKEVIDTNVMGVIWCTREAFN 129
            |.:::....| :|.:   |:|::|||:    .|:.|...|   ::|.|:|||..|::...:|...
 Frog    69 DSIRNCVSSIPDRHI---DILVSNAGV----GLIGPIECQTIEEMKTVMDTNFFGLVRLLKETLP 126

  Fly   130 NMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITET---YRQEFQLHSNKIRV 191
            :|||| ..||::||:|:.|.|.:.|.||      |.|:|||:....|:   ...:|:||.:.|. 
 Frog   127 DMKRR-KSGHIVIISSVMGIQGILFNDV------YAASKFAVEGFCESLAIQALKFKLHLSLIE- 183

  Fly   192 TGICPGAVNT 201
                ||.|.|
 Frog   184 ----PGPVVT 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 64/205 (31%)
NADB_Rossmann 1..247 CDD:304358 64/205 (31%)
XB1000829NP_001096251.1 type1_17beta-HSD-like_SDR_c 4..261 CDD:187666 64/205 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.