DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9147 and C330018D20Rik

DIOPT Version :10

Sequence 1:NP_608990.1 Gene:CG9147 / 33855 FlyBaseID:FBgn0031774 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_084185.1 Gene:C330018D20Rik / 77422 MGIID:1924672 Length:115 Species:Mus musculus


Alignment Length:80 Identity:36/80 - (45%)
Similarity:51/80 - (63%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 LPLLTLYTREPCPLCDDLVEQLEQGFAGQYRLEKVYIDRKENVRFLRLFRHDIPVLFFNGQFLCM 375
            ||:|||:|:.||||||:..|.| |.:..::.|::|.|...||..:...::.||||...|||||.|
Mouse    29 LPVLTLFTKAPCPLCDEAKEVL-QPYKDRFILQEVDITLPENSTWYERYKFDIPVFHLNGQFLMM 92

  Fly   376 HRLNEEALRERLEAL 390
            ||:|...|.::|..|
Mouse    93 HRVNTSKLEKQLRKL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9147NP_608990.1 PaaJ 31..>69 CDD:439953
Glrx-like 314..388 CDD:399055 32/73 (44%)
C330018D20RikNP_084185.1 Glrx-like 32..104 CDD:399055 32/72 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.