DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9147 and si:dkey-184a18.5

DIOPT Version :9

Sequence 1:NP_001285659.1 Gene:CG9147 / 33855 FlyBaseID:FBgn0031774 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001373248.1 Gene:si:dkey-184a18.5 / 492754 ZFINID:ZDB-GENE-091204-187 Length:104 Species:Danio rerio


Alignment Length:77 Identity:35/77 - (45%)
Similarity:50/77 - (64%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 LPLLTLYTREPCPLCDDLVEQLEQGFAGQYRLEKVYIDRKENVRFLRLFRHDIPVLFFNGQFLCM 375
            ||:|||:|::||||||:...:||. :..::.|::|.|...||..:...:|.||||...|||||.|
Zfish    23 LPVLTLFTKDPCPLCDEAKAELEP-YKHRFELQEVDITLPENRVWFDRYRFDIPVFHLNGQFLMM 86

  Fly   376 HRLNEEALRERL 387
            ||:|...|.:.|
Zfish    87 HRVNSTLLEKHL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9147NP_001285659.1 cond_enzymes 32..>117 CDD:299129
DUF836 314..388 CDD:283436 33/74 (45%)
si:dkey-184a18.5NP_001373248.1 DUF836 26..99 CDD:399055 33/74 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10915
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007283
OrthoInspector 1 1.000 - - oto39291
orthoMCL 1 0.900 - - OOG6_107131
Panther 1 1.100 - - LDO PTHR33558
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2343
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.