DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9147 and C5orf63

DIOPT Version :9

Sequence 1:NP_001285659.1 Gene:CG9147 / 33855 FlyBaseID:FBgn0031774 Length:391 Species:Drosophila melanogaster
Sequence 2:XP_016864953.1 Gene:C5orf63 / 401207 HGNCID:40051 Length:145 Species:Homo sapiens


Alignment Length:32 Identity:12/32 - (37%)
Similarity:18/32 - (56%) Gaps:5/32 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 REPCPLCDDLVEQLEQGFAGQYRLEKVYIDRK 350
            ::||||||:..|.|:     .|...:.|.|:|
Human    45 QDPCPLCDEAKEVLK-----PYENRQPYKDQK 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9147NP_001285659.1 cond_enzymes 32..>117 CDD:299129
DUF836 314..388 CDD:283436 12/32 (38%)
C5orf63XP_016864953.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007283
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107131
Panther 1 1.100 - - O PTHR33558
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2343
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.