powered by:
Protein Alignment CG9147 and C5orf63
DIOPT Version :9
Sequence 1: | NP_001285659.1 |
Gene: | CG9147 / 33855 |
FlyBaseID: | FBgn0031774 |
Length: | 391 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016864953.1 |
Gene: | C5orf63 / 401207 |
HGNCID: | 40051 |
Length: | 145 |
Species: | Homo sapiens |
Alignment Length: | 32 |
Identity: | 12/32 - (37%) |
Similarity: | 18/32 - (56%) |
Gaps: | 5/32 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 319 REPCPLCDDLVEQLEQGFAGQYRLEKVYIDRK 350
::||||||:..|.|: .|...:.|.|:|
Human 45 QDPCPLCDEAKEVLK-----PYENRQPYKDQK 71
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9147 | NP_001285659.1 |
cond_enzymes |
32..>117 |
CDD:299129 |
|
DUF836 |
314..388 |
CDD:283436 |
12/32 (38%) |
C5orf63 | XP_016864953.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0007283 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_107131 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR33558 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2343 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.030 |
|
Return to query results.
Submit another query.