DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9147 and c5orf63

DIOPT Version :9

Sequence 1:NP_001285659.1 Gene:CG9147 / 33855 FlyBaseID:FBgn0031774 Length:391 Species:Drosophila melanogaster
Sequence 2:XP_012823734.1 Gene:c5orf63 / 101733920 XenbaseID:XB-GENE-6461375 Length:111 Species:Xenopus tropicalis


Alignment Length:76 Identity:32/76 - (42%)
Similarity:50/76 - (65%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 PLLTLYTREPCPLCDDLVEQLEQGFAGQYRLEKVYIDRKENVRFLRLFRHDIPVLFFNGQFLCMH 376
            |::||:|:.||||||:..|.|.. :..::.||:|.|.:.||..:...:::||||...|||||.||
 Frog    29 PVMTLFTKNPCPLCDEAKEALAP-YMDRFVLEQVDITQPENAAWYDRYKYDIPVFHLNGQFLMMH 92

  Fly   377 RLNEEALRERL 387
            ::|.:.|.:.|
 Frog    93 KVNIKKLEKHL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9147NP_001285659.1 cond_enzymes 32..>117 CDD:299129
DUF836 314..388 CDD:283436 31/74 (42%)
c5orf63XP_012823734.1 DUF836 32..103 CDD:368604 30/71 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12123
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007283
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR33558
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.