DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9147 and C18h5orf63

DIOPT Version :10

Sequence 1:NP_608990.1 Gene:CG9147 / 33855 FlyBaseID:FBgn0031774 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001124475.1 Gene:C18h5orf63 / 100174910 RGDID:2299854 Length:115 Species:Rattus norvegicus


Alignment Length:77 Identity:34/77 - (44%)
Similarity:48/77 - (62%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 LPLLTLYTREPCPLCDDLVEQLEQGFAGQYRLEKVYIDRKENVRFLRLFRHDIPVLFFNGQFLCM 375
            ||:|||:|:.||||||:..|.| |.:..::.|::|.|...||..:...::.||||...|||||..
  Rat    29 LPVLTLFTKHPCPLCDEAKEVL-QPYKNRFILQEVDITLPENSTWYERYKFDIPVFHLNGQFLMK 92

  Fly   376 HRLNEEALRERL 387
            ||:|...|..:|
  Rat    93 HRVNTSKLETQL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9147NP_608990.1 PaaJ 31..>69 CDD:439953
Glrx-like 314..388 CDD:399055 32/74 (43%)
C18h5orf63NP_001124475.1 Glrx-like 32..105 CDD:399055 32/74 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.