DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13994 and YPI1

DIOPT Version :9

Sequence 1:NP_001285658.1 Gene:CG13994 / 33853 FlyBaseID:FBgn0031772 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_116658.1 Gene:YPI1 / 850553 SGDID:S000001899 Length:155 Species:Saccharomyces cerevisiae


Alignment Length:125 Identity:33/125 - (26%)
Similarity:50/125 - (40%) Gaps:37/125 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GSTTEIIDETDARAQLESGRTTPTLLLRLEHPRNERRVAFHAGIIDNEHLNRKKSKCCCIYKKPL 78
            ||.|..::|..|..||.:.:..|.   ..|.......|.:...:||||::|:||:|.|||:    
Yeast    17 GSRTVSVEEVPAVLQLRATQDPPR---SQEAMPTRHNVRWEENVIDNENMNKKKTKICCIF---- 74

  Fly    79 AFGESSSEDDEDCEHCFGHP------------------------EKRQRNAKHNHNHGDK 114
               ...:||:|:|.|   |.                        |:|||..:..|...:|
Yeast    75 ---HPQNEDEEECNH---HSDDDGSSSSGSSSSESENEKDLDFNERRQRRLERRHRKLEK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13994NP_001285658.1 PPI_Ypi1 37..91 CDD:284827 16/53 (30%)
YPI1NP_116658.1 PPI_Ypi1 29..84 CDD:400048 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345660
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - LDO PTHR20835
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1995
SonicParanoid 1 1.000 - - X3525
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.