DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13994 and INH3

DIOPT Version :9

Sequence 1:NP_001285658.1 Gene:CG13994 / 33853 FlyBaseID:FBgn0031772 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_565720.1 Gene:INH3 / 817688 AraportID:AT2G31305 Length:107 Species:Arabidopsis thaliana


Alignment Length:115 Identity:38/115 - (33%)
Similarity:58/115 - (50%) Gaps:18/115 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 STNNETSNGSTTEIIDETDARAQLESGRTTPTLLLRLEHPRNERRVAFHAGIIDNEHLNRKKSKC 70
            ||....|:.:||.:|.|.    .:...:.|..|:|||.  |.:::|::..|.:|||.:.:|.||.
plant     2 STATRPSSSATTSVILEN----PVSQSQPTERLVLRLN--RKKKKVSWKDGTVDNEFMQKKSSKK 60

  Fly    71 CCIYKKPLAFGESSSEDDEDCEHCFGHPEKRQRNAKHNHNHGDKPCTEAS 120
            |||:.|...|.|..||:::|..|          :..|||.|.:.  .|||
plant    61 CCIFHKQKPFDEDDSEEEDDNNH----------HCDHNHEHSES--GEAS 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13994NP_001285658.1 PPI_Ypi1 37..91 CDD:284827 21/53 (40%)
INH3NP_565720.1 PPI_Ypi1 31..>70 CDD:400048 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I2544
OMA 1 1.010 - - QHG54808
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - LDO PTHR20835
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.