DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13994 and Ppp1r11

DIOPT Version :9

Sequence 1:NP_001285658.1 Gene:CG13994 / 33853 FlyBaseID:FBgn0031772 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_083908.1 Gene:Ppp1r11 / 76497 MGIID:1923747 Length:131 Species:Mus musculus


Alignment Length:148 Identity:53/148 - (35%)
Similarity:72/148 - (48%) Gaps:26/148 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ETSNGSTTEIIDETDARAQLESGRTTP---TLLLRLEHPRNERRVAFHAGIIDNEHLNRKKSKCC 71
            ||..| .:|.:.||.......:..|.|   :|.::|...:.|::|.:.:..:||||:.|:.||||
Mouse     3 ETGAG-ISETVTETTVTETTVTETTEPENQSLTMKLRKRKPEKKVEWSSDTVDNEHMGRRSSKCC 66

  Fly    72 CIYKKPLAFGESSSEDDEDCEHCFGHPEKRQRNAKHNHNHGDKPCTEASHPEGPSTSTQAAHISQ 136
            |||:||.||||||:|.|||.|....|     ::....|..|.:|.|.|..|..|         .|
Mouse    67 CIYEKPRAFGESSTESDEDEEEGCSH-----KHCVRGHRKGRRPTTPAPTPTTP---------PQ 117

  Fly   137 PPAEPVESKTDPKPPTPG 154
            ||        ||..|.||
Mouse   118 PP--------DPSKPPPG 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13994NP_001285658.1 PPI_Ypi1 37..91 CDD:284827 27/53 (51%)
Ppp1r11NP_083908.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..131 53/148 (36%)
PPI_Ypi1 34..76 CDD:284827 18/41 (44%)
Atypical RING finger domain 1. /evidence=ECO:0000250|UniProtKB:O60927 57..67 5/9 (56%)
Atypical RING finger domain 2. /evidence=ECO:0000250|UniProtKB:O60927 90..99 1/13 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847605
Domainoid 1 1.000 66 1.000 Domainoid score I9905
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5132
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004272
OrthoInspector 1 1.000 - - otm44026
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - LDO PTHR20835
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1995
SonicParanoid 1 1.000 - - X3525
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.