DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13994 and PPP1R11

DIOPT Version :9

Sequence 1:NP_001285658.1 Gene:CG13994 / 33853 FlyBaseID:FBgn0031772 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_068778.1 Gene:PPP1R11 / 6992 HGNCID:9285 Length:126 Species:Homo sapiens


Alignment Length:138 Identity:50/138 - (36%)
Similarity:68/138 - (49%) Gaps:24/138 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TEIIDETDARAQLESGRTTPTLLLRLEHPRNERRVAFHAGIIDNEHLNRKKSKCCCIYKKPLAFG 81
            :|.:.||......|....:.|:.||...|  |::|.:.:..:||||:.|:.|||||||:||.|||
Human     9 SETVTETTVTVTTEPENRSLTIKLRKRKP--EKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFG 71

  Fly    82 ESSSEDDEDCEHCFGHPEKRQRNAKHNHNHGDKPCTEASHPEGPSTSTQAAHISQPPAEPVESKT 146
            |||:|.||:.|...||     .:....|..|.:..|     .||:.:|       ||..|     
Human    72 ESSTESDEEEEEGCGH-----THCVRGHRKGRRRAT-----LGPTPTT-------PPQPP----- 114

  Fly   147 DPKPPTPG 154
            ||..|.||
Human   115 DPSQPPPG 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13994NP_001285658.1 PPI_Ypi1 37..91 CDD:284827 29/53 (55%)
PPP1R11NP_068778.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 4/15 (27%)
PPI_Ypi1 29..71 CDD:400048 21/43 (49%)
Atypical RING finger domain 1. /evidence=ECO:0000269|PubMed:27805901 52..62 5/9 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..126 25/75 (33%)
Atypical RING finger domain 2. /evidence=ECO:0000269|PubMed:27805901 85..94 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157227
Domainoid 1 1.000 64 1.000 Domainoid score I10148
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5214
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1599272at2759
OrthoFinder 1 1.000 - - FOG0004272
OrthoInspector 1 1.000 - - otm41977
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - LDO PTHR20835
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1995
SonicParanoid 1 1.000 - - X3525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.