DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13994 and ppp1r11

DIOPT Version :10

Sequence 1:NP_608988.1 Gene:CG13994 / 33853 FlyBaseID:FBgn0031772 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001004815.1 Gene:ppp1r11 / 448065 XenbaseID:XB-GENE-999517 Length:119 Species:Xenopus tropicalis


Alignment Length:116 Identity:41/116 - (35%)
Similarity:64/116 - (55%) Gaps:14/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TNNETSNGSTTE--IIDETDARAQLESGRTTPTLLLRLEHPRNERRVAFHAGIIDNEHLNRKKSK 69
            ::..|:.|..|.  :..|:|.:.:..|      |.|:|...:.:::|.:....:|||:|.|:.||
 Frog     4 SSGPTAGGGATSSTVTTESDTQPEHRS------LTLKLRKRKPDKKVEWTCDTVDNENLGRRSSK 62

  Fly    70 CCCIYKKPLAFGESS--SEDDEDC---EHCF-GHPEKRQRNAKHNHNHGDK 114
            |||||:||..|||||  |||::||   .||. ||.:....:.:...:|.||
 Frog    63 CCCIYEKPRPFGESSSESEDEDDCCESAHCIRGHKKATSGSKETPSSHHDK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13994NP_608988.1 PPI_Ypi1 37..91 CDD:429489 26/55 (47%)
ppp1r11NP_001004815.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 9/43 (21%)
PPI_Ypi1 32..74 CDD:429489 17/41 (41%)
Atypical RING finger domain 1. /evidence=ECO:0000250|UniProtKB:O60927 55..65 5/9 (56%)
Atypical RING finger domain 2. /evidence=ECO:0000250|UniProtKB:O60927 87..96 2/8 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..119 4/18 (22%)

Return to query results.
Submit another query.