DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13994 and Ppp1r11

DIOPT Version :9

Sequence 1:NP_001285658.1 Gene:CG13994 / 33853 FlyBaseID:FBgn0031772 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_997707.2 Gene:Ppp1r11 / 294207 RGDID:1303163 Length:127 Species:Rattus norvegicus


Alignment Length:145 Identity:54/145 - (37%)
Similarity:71/145 - (48%) Gaps:24/145 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ETSNGSTTEIIDETDARAQLESGRTTPTLLLRLEHPRNERRVAFHAGIIDNEHLNRKKSKCCCIY 74
            |...|..:|.:.||......|....:.|:.||...|  |::|.:.:..:||||:.|:.|||||||
  Rat     3 EAGAGGLSETVTETTVTVTTEPENRSLTIKLRKRKP--EKKVEWSSDTVDNEHMGRRSSKCCCIY 65

  Fly    75 KKPLAFGESSSEDDEDCEHCFGHPEKRQRNAKHNHNHGDKPCTEASHPEGPSTSTQAAHISQPPA 139
            :||.||||||:|.|||.|...||     .:....|..|.:|.|     .||:.:|       ||.
  Rat    66 EKPRAFGESSTESDEDEEEGCGH-----THCVRGHRKGRRPTT-----PGPTPTT-------PPQ 113

  Fly   140 EPVESKTDPKPPTPG 154
            .|     ||..|.||
  Rat   114 PP-----DPSQPPPG 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13994NP_001285658.1 PPI_Ypi1 37..91 CDD:284827 29/53 (55%)
Ppp1r11NP_997707.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 16/53 (30%)
PPI_Ypi1 30..72 CDD:284827 21/43 (49%)
Atypical RING finger domain 1. /evidence=ECO:0000250|UniProtKB:O60927 53..63 5/9 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..127 28/76 (37%)
Atypical RING finger domain 2. /evidence=ECO:0000250|UniProtKB:O60927 86..95 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351166
Domainoid 1 1.000 66 1.000 Domainoid score I9690
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I5025
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1599272at2759
OrthoFinder 1 1.000 - - FOG0004272
OrthoInspector 1 1.000 - - otm46117
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - LDO PTHR20835
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3525
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.