DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13994 and SPAC6B12.13

DIOPT Version :9

Sequence 1:NP_001285658.1 Gene:CG13994 / 33853 FlyBaseID:FBgn0031772 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_593768.1 Gene:SPAC6B12.13 / 2543302 PomBaseID:SPAC6B12.13 Length:104 Species:Schizosaccharomyces pombe


Alignment Length:99 Identity:36/99 - (36%)
Similarity:48/99 - (48%) Gaps:15/99 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NGSTTEIIDETDARAQLESGRTTPTLLLRLEHPRNERRVAFHAGIIDNEHLNRKKSKCCCIYKKP 77
            :.|.|..|:.|:..|.:....:...|.|:   |...|||.:....:||||:|:||||.|||:.|.
pombe    11 SSSATVTIESTEESASISHEESENVLHLQ---PEPVRRVRWTVSTVDNEHMNKKKSKVCCIFHKQ 72

  Fly    78 LAFGESSSEDDED------CEHCFGHPEKRQRNA 105
            ..|.||||:.|.|      |..|.      .|||
pombe    73 RKFDESSSDSDSDSDSDSSCSSCC------SRNA 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13994NP_001285658.1 PPI_Ypi1 37..91 CDD:284827 26/59 (44%)
SPAC6B12.13NP_593768.1 PPI_Ypi1 35..77 CDD:284827 20/44 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I3192
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004272
OrthoInspector 1 1.000 - - oto102141
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - LDO PTHR20835
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1995
SonicParanoid 1 1.000 - - X3525
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.