DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13994 and ZK945.8

DIOPT Version :9

Sequence 1:NP_001285658.1 Gene:CG13994 / 33853 FlyBaseID:FBgn0031772 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_496183.1 Gene:ZK945.8 / 191472 WormBaseID:WBGene00014170 Length:109 Species:Caenorhabditis elegans


Alignment Length:82 Identity:38/82 - (46%)
Similarity:49/82 - (59%) Gaps:8/82 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LLLRLEHPRNERRVAFHAGIIDNEHLNRKKSKCCCIYKKPLAFGESSS--EDDEDCEHCFGH--P 98
            |:|||..|....||.:.||:|||||:.|.||.|||||..|..:.:.|:  .::.:.|||.||  |
 Worm    19 LVLRLRAPVERPRVTWGAGVIDNEHMGRLKSNCCCIYTPPRVWDDPSTWEPEEHETEHCRGHTLP 83

  Fly    99 EKRQRNAKHNHNHG-DK 114
            ||:|   |....|| ||
 Worm    84 EKKQ---KPQGGHGSDK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13994NP_001285658.1 PPI_Ypi1 37..91 CDD:284827 24/54 (44%)
ZK945.8NP_496183.1 PPI_Ypi1 20..72 CDD:284827 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I7757
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004272
OrthoInspector 1 1.000 - - mtm4825
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - O PTHR20835
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1995
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.