DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13994 and ZK945.8

DIOPT Version :10

Sequence 1:NP_608988.1 Gene:CG13994 / 33853 FlyBaseID:FBgn0031772 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_496183.1 Gene:ZK945.8 / 191472 WormBaseID:WBGene00014170 Length:109 Species:Caenorhabditis elegans


Alignment Length:82 Identity:38/82 - (46%)
Similarity:49/82 - (59%) Gaps:8/82 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LLLRLEHPRNERRVAFHAGIIDNEHLNRKKSKCCCIYKKPLAFGESSS--EDDEDCEHCFGH--P 98
            |:|||..|....||.:.||:|||||:.|.||.|||||..|..:.:.|:  .::.:.|||.||  |
 Worm    19 LVLRLRAPVERPRVTWGAGVIDNEHMGRLKSNCCCIYTPPRVWDDPSTWEPEEHETEHCRGHTLP 83

  Fly    99 EKRQRNAKHNHNHG-DK 114
            ||:|   |....|| ||
 Worm    84 EKKQ---KPQGGHGSDK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13994NP_608988.1 PPI_Ypi1 37..91 CDD:429489 24/54 (44%)
ZK945.8NP_496183.1 PPI_Ypi1 20..72 CDD:429489 23/51 (45%)

Return to query results.
Submit another query.