DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13994 and K10H10.7

DIOPT Version :9

Sequence 1:NP_001285658.1 Gene:CG13994 / 33853 FlyBaseID:FBgn0031772 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_497013.1 Gene:K10H10.7 / 187286 WormBaseID:WBGene00010763 Length:132 Species:Caenorhabditis elegans


Alignment Length:107 Identity:36/107 - (33%)
Similarity:61/107 - (57%) Gaps:13/107 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SNGSTTEIIDETDARAQLESGRTTPTLLLRLEHPRNERRVAFHAGIIDNEHLNRKKSKCCCIYKK 76
            ||.:||.::.:::.:.:::...     :|||..|.:...|.:..|::||||:.|.||.|||||..
 Worm     4 SNTTTTTLVVKSEDQEEVQEEH-----VLRLRAPPSPPHVTWAEGVVDNEHMGRLKSNCCCIYVA 63

  Fly    77 PLAFGESSS-EDDE-DCEHCFGH--PEKRQRNAKHNHNHGDK 114
            |..:.:.|: |.:| :.|||.||  ||::    |...:.||:
 Worm    64 PRQWDDPSTWEPNEYETEHCRGHTLPERK----KKKEDGGDE 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13994NP_001285658.1 PPI_Ypi1 37..91 CDD:284827 22/55 (40%)
K10H10.7NP_497013.1 PPI_Ypi1 26..77 CDD:284827 21/50 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I7757
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3938
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1599272at2759
OrthoFinder 1 1.000 - - FOG0004272
OrthoInspector 1 1.000 - - mtm4825
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - O PTHR20835
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.