DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13994 and C07H6.2

DIOPT Version :9

Sequence 1:NP_001285658.1 Gene:CG13994 / 33853 FlyBaseID:FBgn0031772 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_498652.1 Gene:C07H6.2 / 182382 WormBaseID:WBGene00015579 Length:107 Species:Caenorhabditis elegans


Alignment Length:118 Identity:42/118 - (35%)
Similarity:62/118 - (52%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAHKQSTNNETSNGSTTEIIDETDARAQLESGRTTPTLLLRL-----EHPRNERR-VAFHAGIID 59
            |:|   |..:|::.:.|..:....:|.|        .|:|.|     :...:||| |.:....:|
 Worm     1 MSH---TQQQTASSTETSTVTVPPSREQ--------NLVLHLSPNPAQPSTSERRHVVWATETVD 54

  Fly    60 NEHLNRKKSKCCCIYKKPLAFGESSSEDDEDCE--HCFGHPEKRQRNAKHNHN 110
            ||.:.:||||||||||||..:.:|||:.|.|||  ||.||.|.::.....:.|
 Worm    55 NEGMGKKKSKCCCIYKKPKNWQDSSSDSDSDCETGHCRGHVEHKKNEEPKSSN 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13994NP_001285658.1 PPI_Ypi1 37..91 CDD:284827 26/59 (44%)
C07H6.2NP_498652.1 PPI_Ypi1 28..>75 CDD:284827 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165393
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3938
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54808
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - LDO PTHR20835
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1995
SonicParanoid 1 1.000 - - X3525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.