powered by:
Protein Alignment CG13995 and ZK863.1
DIOPT Version :9
Sequence 1: | NP_608986.1 |
Gene: | CG13995 / 33851 |
FlyBaseID: | FBgn0031770 |
Length: | 545 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_506054.2 |
Gene: | ZK863.1 / 191444 |
WormBaseID: | WBGene00014122 |
Length: | 370 |
Species: | Caenorhabditis elegans |
Alignment Length: | 57 |
Identity: | 21/57 - (36%) |
Similarity: | 26/57 - (45%) |
Gaps: | 10/57 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 411 LRSRRHLA----NMLIASAVIFIAC--WAPHVFCIFYKNFGNNQQ---CSQTSVYFS 458
|||||.|. |.|:...:|...| |||........:.|||.| |:: ..|||
Worm 123 LRSRRRLPRSTWNTLLIILLISCTCQIWAPITITELSFSPGNNSQGTYCAE-DPYFS 178
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR24224 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.