DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13995 and srv-24

DIOPT Version :9

Sequence 1:NP_608986.1 Gene:CG13995 / 33851 FlyBaseID:FBgn0031770 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_500957.1 Gene:srv-24 / 190646 WormBaseID:WBGene00005735 Length:328 Species:Caenorhabditis elegans


Alignment Length:220 Identity:47/220 - (21%)
Similarity:79/220 - (35%) Gaps:70/220 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LLLAVCIADLLVTGISAPVTLLNLAMNRRTRSLPLVLCKVIHYVQVMPVSAS--TISFFM----- 164
            :||..||.|:    |:...::||..:    |::.::...:.:|......:||  ::.:|:     
 Worm    39 ILLQHCIVDI----IAMTFSILNTGL----RNILVIRQFMFNYQDYYLAAASYNSVYYFLYIRCT 95

  Fly   165 ----LSLDRYATVKHPRLAQLRQRRYLHVSLALLS--WLASAAISTPFL----FAY------KII 213
                |||.||..:..| .:.|.|:........::|  |.....||...|    |.|      .||
 Worm    96 GIIFLSLQRYLIITAP-TSMLTQKVQFASKFQIISIYWGVPTLISLVVLKDTNFKYDSLESMSII 159

  Fly   214 AKSMVVKGGGAANTTPNPVSISCTSDLGANAMFMSFIIFHTIAVFVLPGIGVLLNHYGVRRKLCA 278
            |:..|:|    .||                  .|:.|:.....:......|.|.  |.:|:....
 Worm   160 AEQEVIK----RNT------------------LMALIVVSLTCILCSLAYGALF--YYIRKHTAG 200

  Fly   279 LSLTARAAHGELPLPIPILRRQTHM 303
            ||.:              |||:.|:
 Worm   201 LSRS--------------LRREVHL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13995NP_608986.1 7tm_1 88..>276 CDD:278431 41/191 (21%)
srv-24NP_500957.1 7TM_GPCR_Srv 4..283 CDD:370977 47/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24224
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.