DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13995 and ops-1

DIOPT Version :9

Sequence 1:NP_608986.1 Gene:CG13995 / 33851 FlyBaseID:FBgn0031770 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_500956.1 Gene:ops-1 / 188465 WormBaseID:WBGene00005744 Length:341 Species:Caenorhabditis elegans


Alignment Length:239 Identity:48/239 - (20%)
Similarity:86/239 - (35%) Gaps:69/239 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LVLTLCSASSVRLR----------NPLLLAVCIADLLVTGISAPVTLLNLAMNRRTRSLPLVLCK 145
            ||:.:|   .:|||          ..:||..||||||        .:|...:....|::||:...
 Worm    31 LVVFVC---LLRLRYVSKTYNSTFYSILLQHCIADLL--------AMLIFFVTNPMRTIPLIREF 84

  Fly   146 VIHY--VQVMPVSASTISFFM---------LSLDRYATVKHPRLA-QLRQRRYLHVSLALLSWLA 198
            ..:|  ..:...|.::|.:|:         |||.||..:..|.|. ..:.:....:::.::.|:.
 Worm    85 FFNYQSFYIAAASYNSIYYFLYIRCTGIIFLSLQRYFVICCPMLQFTYKIQNASKLTIVVIYWIV 149

  Fly   199 SAAISTPFL----FAYKIIAKSMVVKGGGAANTTPNPVSISCTSDLGANAMFMSFIIFHTIAVFV 259
            ...||...|    |:|....:                ::|....|:......|:.::.....:..
 Worm   150 PTVISAVVLKDTDFSYDSFER----------------MAIIADQDVIQRNTLMALVVVGLTCILC 198

  Fly   260 LPGIGVLLNHYGVRRKLCALSLTARAAHGELPLPIPILRRQTHM 303
            ....|.|.  |.:|:....||.:              |||:.|:
 Worm   199 SLAYGALF--YYIRKHTAGLSRS--------------LRRELHL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13995NP_608986.1 7tm_1 88..>276 CDD:278431 42/210 (20%)
ops-1NP_500956.1 7TM_GPCR_Srv 19..298 CDD:370977 48/239 (20%)
TM helix 2 51..74 CDD:341315 9/30 (30%)
TM helix 3 86..124 CDD:341315 9/37 (24%)
TM helix 4 137..157 CDD:341315 3/19 (16%)
TM helix 5 179..204 CDD:341315 1/24 (4%)
TM helix 6 221..247 CDD:341315 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24224
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.