DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13995 and srv-19

DIOPT Version :10

Sequence 1:NP_608986.1 Gene:CG13995 / 33851 FlyBaseID:FBgn0031770 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_500878.3 Gene:srv-19 / 186684 WormBaseID:WBGene00005730 Length:271 Species:Caenorhabditis elegans


Alignment Length:61 Identity:15/61 - (24%)
Similarity:27/61 - (44%) Gaps:21/61 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 VIFIACWAPH-VFC-IFYKNFGNNQQCSQTSVYFSLLLGYFYSAISPVIYWALNHNSLRQS 484
            ::|: .|.|. :|| |||         |.|.:.        |.:...::| .:|.|.:::|
 Worm    89 IVFL-YWIPSTIFCIIFY---------SSTEIK--------YESPERMVY-VMNPNIIKKS 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13995NP_608986.1 7tm_classA_rhodopsin-like 88..477 CDD:410626 12/52 (23%)
TM helix 2 107..130 CDD:410626
TM helix 3 144..174 CDD:410626
TM helix 4 187..206 CDD:410626
TM helix 5 246..377 CDD:410626
TM helix 6 412..442 CDD:410626 7/17 (41%)
TM helix 7 453..477 CDD:410626 3/23 (13%)
srv-19NP_500878.3 7tm_GPCRs 1..245 CDD:475119 15/61 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.