DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13995 and T01B11.1

DIOPT Version :9

Sequence 1:NP_608986.1 Gene:CG13995 / 33851 FlyBaseID:FBgn0031770 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_501437.2 Gene:T01B11.1 / 177645 WormBaseID:WBGene00020138 Length:343 Species:Caenorhabditis elegans


Alignment Length:247 Identity:45/247 - (18%)
Similarity:87/247 - (35%) Gaps:62/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LQQWWENSYRRQHPEPTDDLGLDSAELHLALQEPNQLPADYDYGNFSLGNPYDVDSEHSISPLTL 70
            |.|.|...:..:.....||.     :|....:....:.:|:.|...::|..:             
 Worm   140 LTQSWSLIFIEEVTMMADDF-----QLIGVCERDVDIMSDFGYRILAIGEAF------------- 186

  Fly    71 LLLAVSYGLVVFGGVV---------GNSTLVLTLCSASSVRLRNPLLLAVCIADLLVTGISAPVT 126
                |:|.......:|         .||:.|  :.||.::|..:..||.|.....:.:..|    
 Worm   187 ----VTYAFPFLFTIVMDIAVLYQSANSSFV--VMSAENIRSEHNTLLHVNETVKIQSSQS---- 241

  Fly   127 LLNLAMNRRTRSLPLVLCKVIHYVQVMPVSASTISFFMLSLDRYATVKHPRLAQLRQRRYLHVSL 191
               :..:.|.|...:..|.::..:||           .|:...|.......:..||....|::.|
 Worm   242 ---IKQSNRRRHQAVRRCLMMATIQV-----------SLNAPYYTLQLCDEIFSLRNSTSLYLYL 292

  Fly   192 -ALLSWLASAAISTPFLFAYKII--AKSMVVKGGGAANTTPNPVSISCTSDL 240
             |:|.::        :|..:.:|  ..:::|...|.:...||.:.:|||:.|
 Worm   293 DAILYFI--------YLLQFSMIYCYTNLLVAPRGKSCRQPNKMPLSCTTSL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13995NP_608986.1 7tm_1 88..>276 CDD:278431 33/156 (21%)
T01B11.1NP_501437.2 7tm_GPCRs 18..312 CDD:391938 37/221 (17%)
TM helix 1 18..40 CDD:341315
TM helix 2 47..68 CDD:341315
TM helix 3 80..110 CDD:341315
TM helix 4 126..145 CDD:341315 2/4 (50%)
TM helix 5 177..202 CDD:341315 5/41 (12%)
TM helix 6 247..277 CDD:341315 7/40 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24224
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.