DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and RCCD1

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001017919.1 Gene:RCCD1 / 91433 HGNCID:30457 Length:376 Species:Homo sapiens


Alignment Length:351 Identity:78/351 - (22%)
Similarity:127/351 - (36%) Gaps:125/351 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EDLLATLEKTPG----------QMLIAGMVTW------DLTGKRD----------------RKNV 98
            |.|||.|...||          :..:.|...|      :..|:.|                |..|
Human    80 EGLLAVLRAGPGPEALLQVWAAESALRGEPLWAQNVVPEAEGEDDPAGEAQAGRLPLLPCARAYV 144

  Fly    99 TKVRPNLYSFHR--FTEEKYRYVASGPSAAHTILINMDRKALGFGRNPSGQLG---LSQDIKLAE 158
            :...|    |:|  ..|.:.|.:..|  |.|.:|::...:...:|....||||   |..::    
Human   145 SPRAP----FYRPLAPELRARQLELG--AEHALLLDAAGQVFSWGGGRHGQLGHGTLEAEL---- 199

  Fly   159 KPTIIPALEQLNIVQAAVGRHHTLFLTDTGTVYACGENKSGQCGV--------GNTHANIYSPTP 215
            :|.::.||:.|.:.:.|.|..|::.:::||.:|..|.|:|||..:        |.|.|.  ..|.
Human   200 EPRLLEALQGLVMAEVAAGGWHSVCVSETGDIYIWGWNESGQLALPTRNLAEDGETVAR--EATE 262

  Fly   216 INYRGPPIIRIGCGAE------------FSVILDIKGSLHTFGLPEYGQLGHNTDAKYFVNANKL 268
            :|..|..:.|.| |||            |..:||:                              
Human   263 LNEDGSQVKRTG-GAEDGAPAPFIAVQPFPALLDL------------------------------ 296

  Fly   269 SFHFETSPKKVVLYIEKSKEGHVTPVDGVQIVDFACGNNHTVAIDSKKRVYSWGFGGFGRLGHAE 333
                                    |: |...|..:||:.||..:.....:|:||:|.:|:|||.:
Human   297 ------------------------PM-GSDAVKASCGSRHTAVVTRTGELYTWGWGKYGQLGHED 336

  Fly   334 PKDEMVPRLMKFFDTQGRGGRSVFCG 359
            ......||.:::|..:....::|.||
Human   337 TTSLDRPRRVEYFVDKQLQVKAVTCG 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 13/47 (28%)
RCC1_2 171..200 CDD:290274 9/28 (32%)
RCC1 188..236 CDD:278826 19/67 (28%)
RCC1 239..312 CDD:278826 7/72 (10%)
RCC1 317..366 CDD:278826 14/43 (33%)
RCC1 414..465 CDD:278826
RCCD1NP_001017919.1 Interaction with KDM8. /evidence=ECO:0000269|PubMed:24981860 1..169 20/94 (21%)
ATS1 <156..340 CDD:227511 56/247 (23%)
RCC1 2 176..227 13/54 (24%)
RCC1 3 229..317 28/145 (19%)
RCC1 4 318..371 14/45 (31%)
RCC1 319..366 CDD:395335 14/44 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.