DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and EEA1

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_011537116.1 Gene:EEA1 / 8411 HGNCID:3185 Length:1453 Species:Homo sapiens


Alignment Length:310 Identity:58/310 - (18%)
Similarity:110/310 - (35%) Gaps:62/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKKESDYEDEFSDESDDDGVQQQAAAANQMEVLIPHDDLDPPSKLPEDLLATLEKTPGQMLIAGM 84
            ::.::|.|.......|.|...|...|..|..    .:::....|..|||.|.::...|:..:...
Human   547 REAQNDLEQVLRQIGDKDQKIQNLEALLQKS----KENISLLEKEREDLYAKIQAGEGETAVLNQ 607

  Fly    85 V----------TWDLTGKRDRKNVT--KVRPNLYSFHRFTEEKYRYVASGPSAAHTILINMDRKA 137
            :          ...||.|...::.:  :.:.||   |...:|:..::    .||...:::::...
Human   608 LQEKNHTLQEQVTQLTEKLKNQSESHKQAQENL---HDQVQEQKAHL----RAAQDRVLSLETSV 665

  Fly   138 --LGFGRNPSGQLGLSQDIKLAEKPTIIPALEQLNIVQAAVGRHH---------------TLFLT 185
              |....|.|.:.....||::..|..::.:.|.....|.|..::|               ....|
Human   666 NELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELNKITT 730

  Fly   186 DTGTVYACGENKSGQCGVGNTHANIYSPTPINYRGP------PIIRIGCGAEFSVILDIKGSLHT 244
            ....|.|..::|...|....:|...|....::....      .|.::...:     |::|.|...
Human   731 QLDQVTAKLQDKQEHCSQLESHLKEYKEKYLSLEQKTEELEGQIKKLEADS-----LEVKASKEQ 790

  Fly   245 F--GLPEYGQLGHNTDAKYFVNANKLSFHFETSPKKVV----LYIEKSKE 288
            .  .|.:..||  |||.:  :.|.:||...|.. |::|    |.::|..|
Human   791 ALQDLQQQRQL--NTDLE--LRATELSKQLEME-KEIVSSTRLDLQKKSE 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 9/59 (15%)
RCC1_2 171..200 CDD:290274 7/43 (16%)
RCC1 188..236 CDD:278826 7/53 (13%)
RCC1 239..312 CDD:278826 17/56 (30%)
RCC1 317..366 CDD:278826
RCC1 414..465 CDD:278826
EEA1XP_011537116.1 Myosin_tail_1 308..1382 CDD:279860 58/310 (19%)
DUF342 <425..519 CDD:302792
FYVE_EEA1 1389..1451 CDD:277269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.