DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and AT3G02300

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001327030.1 Gene:AT3G02300 / 821167 AraportID:AT3G02300 Length:482 Species:Arabidopsis thaliana


Alignment Length:410 Identity:88/410 - (21%)
Similarity:136/410 - (33%) Gaps:161/410 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 FGRNPSGQLGLSQDIKLAEKPTII-------PALEQLNIVQAAVGRHHTLFLTDTGTVYACGENK 197
            :|.|.|||.|.::..||...|..:       ||......:..:.||.||..:...|:::|.|.|:
plant    36 WGYNQSGQTGRNEQEKLLRIPKQLPPELFGCPAGANSRWLDISCGREHTAAVASDGSLFAWGANE 100

  Fly   198 SGQCG----VGNTH----------------------ANIYSP----------------------T 214
            .||.|    ||..|                      |.|..|                      .
plant   101 YGQLGDGTEVGRKHPKKVKQLQSEFVKFVSCGAFCTAAIAEPRENDGTLSTSRLWVWGQNQGSNL 165

  Fly   215 PINYRG-----PPIIRIGCGAEFSVILDIKGSLHTFGLPEYGQLGH-------------NTDAKY 261
            |..:.|     ..|.::.||....|.|..:|.|..:|..|.||||.             |..||:
plant   166 PRLFSGAFPATTAIRQVSCGTAHVVALSEEGLLQAWGYNEQGQLGRGVTCEGLQAPRVINAYAKF 230

  Fly   262 FVNANKLSFHFETSPKKVVLYIEKSKEGHVTPVDGVQIVDFACGNNHTVAIDSKKRVYSWGFGGF 326
            ...|.:|                            |:|:..:||..||.|:.....||:||.|..
plant   231 LDEAPEL----------------------------VKIMQLSCGEYHTAALSDAGEVYTWGLGSM 267

  Fly   327 GRLGHAEPKDEMVPRLMKFFDTQGRGGRSVFCGSTFSLIVNELGLLFLFGQNKKTGEANMYPKPV 391
            |:|||.                                             :.::|:..:.|:.|
plant   268 GQLGHV---------------------------------------------SLQSGDKELIPRRV 287

  Fly   392 QDLSGWNITDIGCANT-SIMISADDTLIAWGASPTFGELGIGE--------FQKSSTVPKEVPKL 447
            ..|.|.::.::.|... :..:|.:..|.|||.... |:||:|.        ...|..:.:.||.|
plant   288 VGLDGVSMKEVACGGVHTCALSLEGALYAWGGGQA-GQLGLGPQSGFFFSVSNGSEMLLRNVPVL 351

  Fly   448 ---DNIKIPQVTMGYSHTVL 464
               .::::  |..|:|||::
plant   352 VIPTDVRL--VACGHSHTLV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 15/50 (30%)
RCC1_2 171..200 CDD:290274 8/28 (29%)
RCC1 188..236 CDD:278826 19/100 (19%)
RCC1 239..312 CDD:278826 19/85 (22%)
RCC1 317..366 CDD:278826 9/48 (19%)
RCC1 414..465 CDD:278826 17/62 (27%)
AT3G02300NP_001327030.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.