DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and hectd3

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001072497.1 Gene:hectd3 / 779952 XenbaseID:XB-GENE-5937967 Length:845 Species:Xenopus tropicalis


Alignment Length:208 Identity:47/208 - (22%)
Similarity:76/208 - (36%) Gaps:52/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RRPKKKESDYEDEFSDES-DDDGVQQQAAAANQMEVLIPHDDLDPPSKLP--------------- 65
            |.|.:.|..:|.:|..|. .|.|...:.:.|:..|.|.| ...|.|..||               
 Frog   503 RWPVRYEQWWECKFIAEGIIDQGGGFRDSLADISEELCP-SSADIPVPLPFFVRTSNQGNGTGEA 566

  Fly    66 EDL---------LATLEKTPGQML-------------IAGMVTWDLTGK-----RDRKNVTKVRP 103
            :|:         ||..|.. ||::             :.|:|...|||:     :|...|..:..
 Frog   567 QDMYVPNPSCKDLAKYEWI-GQLMGAALRGKEFLVLALPGLVWKQLTGEEVSWSKDFPAVDSLLV 630

  Fly   104 NLYS-FHRFTEEKYRYVASGPSAAHTILINMDRKALGFGRNPSGQLGLSQD----IKLAEKPTII 163
            .|.. .....||.:.:..||.....|:|  .|:|.:......|....|.:|    |::.:|..:.
 Frog   631 KLLEMMELMDEETFEFKFSGELTYTTVL--SDQKMVELVPGGSNISVLYKDRVEFIRMVQKARLE 693

  Fly   164 PALEQLNIVQAAV 176
            .:.||:..:||.:
 Frog   694 ESKEQIGALQAGL 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 9/42 (21%)
RCC1_2 171..200 CDD:290274 2/6 (33%)
RCC1 188..236 CDD:278826
RCC1 239..312 CDD:278826
RCC1 317..366 CDD:278826
RCC1 414..465 CDD:278826
hectd3NP_001072497.1 APC10-HECTD3 222..355 CDD:176487
HECTc 512..837 CDD:421431 44/199 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.