DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and Hectd3

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_780453.1 Gene:Hectd3 / 76608 MGIID:1923858 Length:861 Species:Mus musculus


Alignment Length:145 Identity:29/145 - (20%)
Similarity:51/145 - (35%) Gaps:46/145 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 IEKSKEG---------HVTPVDGVQIVDF------ACGNNHTVAIDSKKRVYSWGFGGFGRLGHA 332
            :|:|||.         .|.|...:.::.:      .||:.. |.:|:.:::        .|....
Mouse   708 LEESKEQVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPE-VTVDALRKL--------TRFEDF 763

  Fly   333 EPKDEMVPRLMKFFDTQGRGGRSVFCGSTFSLIVNELGLLFLFGQNKKTGEANMYPKPVQDLSGW 397
            ||.|..|....:..:......||.|             |.|:.|:::......:||    |..|:
Mouse   764 EPSDTRVQYFWEALNNFTNEDRSRF-------------LRFVTGRSRLPARIYIYP----DKLGY 811

  Fly   398 NITDI-----GCANT 407
            ..||.     .|::|
Mouse   812 ETTDALPESSTCSST 826

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826
RCC1_2 171..200 CDD:290274
RCC1 188..236 CDD:278826
RCC1 239..312 CDD:278826 9/43 (21%)
RCC1 317..366 CDD:278826 8/48 (17%)
RCC1 414..465 CDD:278826
Hectd3NP_780453.1 APC10-HECTD3 238..371 CDD:176487
HECTc 528..849 CDD:214523 29/145 (20%)
HECT 586..845 CDD:279026 29/145 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.