| Sequence 1: | NP_001285655.1 | Gene: | CG9135 / 33850 | FlyBaseID: | FBgn0031769 | Length: | 487 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001153420.2 | Gene: | Als2 / 74018 | MGIID: | 1921268 | Length: | 1651 | Species: | Mus musculus |
| Alignment Length: | 240 | Identity: | 53/240 - (22%) |
|---|---|---|---|
| Similarity: | 82/240 - (34%) | Gaps: | 79/240 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 127 HTILINMDRKALGFGRNPSGQLGLSQDIKLA-EKPTIIPALEQLNIVQAAVGRHHTLFLTDTGTV 190
Fly 191 YACGENKSGQCGVGNTHANIYSPTPINYRGPPIIRIGCGAEFSVILDIKGSLHTFGLPEYGQLGH 255
Fly 256 NTDAKYFVNANKLSFHFETSPKKVVLYIEKSKEGHVTPVDGVQIVDFACGNNHTVAIDSKKRVYS 320
Fly 321 WGFG-GFGRLGHAEPKDEMVPRLMKFFDTQGRGGRSVFCGSTFSL 364 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9135 | NP_001285655.1 | RCC1 | 139..184 | CDD:278826 | 10/45 (22%) |
| RCC1_2 | 171..200 | CDD:290274 | 10/28 (36%) | ||
| RCC1 | 188..236 | CDD:278826 | 14/47 (30%) | ||
| RCC1 | 239..312 | CDD:278826 | 10/72 (14%) | ||
| RCC1 | 317..366 | CDD:278826 | 14/49 (29%) | ||
| RCC1 | 414..465 | CDD:278826 | |||
| Als2 | NP_001153420.2 | RCC1 1. /evidence=ECO:0000305 | 59..108 | 11/52 (21%) | |
| RCC1_2 | 93..122 | CDD:290274 | 10/28 (36%) | ||
| RCC1 2. /evidence=ECO:0000305 | 109..167 | 25/126 (20%) | |||
| RCC1 | 109..165 | CDD:278826 | 24/124 (19%) | ||
| RCC1 3. /evidence=ECO:0000305 | 169..218 | 14/50 (28%) | |||
| RCC1 | 170..216 | CDD:278826 | 14/49 (29%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 425..462 | ||||
| RCC1 4. /evidence=ECO:0000305 | 519..570 | ||||
| RCC1 | 521..568 | CDD:278826 | |||
| RCC1 5. /evidence=ECO:0000305 | 572..621 | ||||
| RCC1 | 573..619 | CDD:278826 | |||
| RhoGEF | 689..873 | CDD:295373 | |||
| PH_alsin | 899..1004 | CDD:241423 | |||
| PH | 920..998 | CDD:278594 | |||
| COG4642 | 1043..1182 | CDD:226989 | |||
| MORN 1 | 1043..1065 | ||||
| MORN | 1043..1063 | CDD:280628 | |||
| MORN 2 | 1066..1088 | ||||
| MORN 3 | 1094..1116 | ||||
| MORN | 1094..1114 | CDD:280628 | |||
| MORN 4 | 1117..1139 | ||||
| MORN 5 | 1145..1167 | ||||
| COG4642 | 1166..>1266 | CDD:226989 | |||
| MORN 6 | 1169..1191 | ||||
| MORN 7 | 1192..1214 | ||||
| MORN 8 | 1215..1238 | ||||
| VPS9 | 1548..1647 | CDD:280383 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||