Sequence 1: | NP_001285655.1 | Gene: | CG9135 / 33850 | FlyBaseID: | FBgn0031769 | Length: | 487 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_065970.2 | Gene: | ALS2 / 57679 | HGNCID: | 443 | Length: | 1657 | Species: | Homo sapiens |
Alignment Length: | 241 | Identity: | 55/241 - (22%) |
---|---|---|---|
Similarity: | 81/241 - (33%) | Gaps: | 81/241 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 HTILINMDRKALGFGRNP--SGQLGLSQDIKLAEKPTIIPALEQLNIVQAAVGRHHTLFLTDTGT 189
Fly 190 VYACGENKSGQCGVGNTHANIYSPTPINYRGPPIIRIGCGAEFSVILDIKGSLHTFGLPEYGQLG 254
Fly 255 HNTDAKYFVNANKLSFHFETSPKKVVLYIEKSKEGHVTPVDGVQIVDFACGNNHTVAIDSKKRVY 319
Fly 320 SWGFG-GFGRLGHAEPKDEMVPRLMKFFDTQGRGGRSVFCGSTFSL 364 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9135 | NP_001285655.1 | RCC1 | 139..184 | CDD:278826 | 11/46 (24%) |
RCC1_2 | 171..200 | CDD:290274 | 10/28 (36%) | ||
RCC1 | 188..236 | CDD:278826 | 13/47 (28%) | ||
RCC1 | 239..312 | CDD:278826 | 10/72 (14%) | ||
RCC1 | 317..366 | CDD:278826 | 15/49 (31%) | ||
RCC1 | 414..465 | CDD:278826 | |||
ALS2 | NP_065970.2 | RCC1 1. /evidence=ECO:0000305 | 59..108 | 12/53 (23%) | |
RCC1_2 | 93..122 | CDD:290274 | 10/28 (36%) | ||
RCC1 2. /evidence=ECO:0000305 | 109..167 | 24/126 (19%) | |||
RCC1 | 109..165 | CDD:278826 | 23/124 (19%) | ||
RCC1 3. /evidence=ECO:0000305 | 169..218 | 15/50 (30%) | |||
RCC1 | 170..216 | CDD:278826 | 15/49 (31%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 432..480 | ||||
RCC1 4. /evidence=ECO:0000305 | 525..576 | ||||
RCC1 | 527..574 | CDD:278826 | |||
RCC1 5. /evidence=ECO:0000305 | 578..627 | ||||
RCC1 | 579..625 | CDD:278826 | |||
RhoGEF | 695..879 | CDD:295373 | |||
PH_alsin | 905..1010 | CDD:241423 | |||
PH | 926..1004 | CDD:278594 | |||
COG4642 | 1049..1188 | CDD:226989 | |||
MORN 1 | 1049..1071 | ||||
MORN | 1049..1069 | CDD:280628 | |||
MORN 2 | 1072..1094 | ||||
MORN 3 | 1100..1122 | ||||
MORN | 1100..1120 | CDD:280628 | |||
MORN 4 | 1123..1145 | ||||
MORN 5 | 1151..1173 | ||||
MORN 6 | 1175..1197 | ||||
MORN 7 | 1198..1220 | ||||
MORN 8 | 1221..1244 | ||||
VPS9 | 1554..1653 | CDD:280383 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |