DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and hectd3

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001070627.2 Gene:hectd3 / 563189 ZFINID:ZDB-GENE-031118-179 Length:854 Species:Danio rerio


Alignment Length:212 Identity:47/212 - (22%)
Similarity:70/212 - (33%) Gaps:79/212 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 HAEPKDEMVPRLMKFFDTQGRGGRSVF------CGSTFSLIVNELGLLFLFGQNKKTGEAN---- 385
            |.|..|.:||  ::..||..| .:.:|      | :.:..:|:....|.: |...|..||:    
Zfish   138 HTEGGDRLVP--VESADTISR-QQQLFGYDHKPC-NRWEQVVDVENSLHM-GAKPKVAEADEAAV 197

  Fly   386 ---MYPKPV------QDLSGWNITDIG-----------CANTSIMISAD--------------DT 416
               .|..|.      :||..:....||           |. |||.:|:.              ||
Zfish   198 RKLRYVPPTWTFECDEDLVHYFYDHIGKEDENLGSVKQCV-TSIDVSSSSEDPSGGASCLTDGDT 261

  Fly   417 LIAWGASPTFGELGIGEFQKSSTVPKEVPKLDNIKIPQVTMGYSHTVLLVDTTHEATKQK----- 476
            ...|.:....|:..|....:..||   |.||               :|.||:|.:....|     
Zfish   262 ETYWESDGMQGQHWIRLHMRRGTV---VNKL---------------ILTVDSTDDNYMPKRVTVY 308

  Fly   477 ------YEKMPEYTIDD 487
                  .:|..:.||||
Zfish   309 GGEGDNLKKYSDVTIDD 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826
RCC1_2 171..200 CDD:290274
RCC1 188..236 CDD:278826
RCC1 239..312 CDD:278826
RCC1 317..366 CDD:278826 10/40 (25%)
RCC1 414..465 CDD:278826 10/64 (16%)
hectd3NP_001070627.2 APC10-HECTD3 231..366 CDD:176487 25/114 (22%)
HECTc 523..842 CDD:214523
HECT 561..838 CDD:279026
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.