DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and RCBTB1

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001339429.1 Gene:RCBTB1 / 55213 HGNCID:18243 Length:531 Species:Homo sapiens


Alignment Length:360 Identity:82/360 - (22%)
Similarity:134/360 - (37%) Gaps:101/360 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 GPSAAHTILINMDRKALGFGRNPSGQLGLSQDIKLAEKPTIIP-ALEQL---NIVQAAVGR-HHT 181
            |.||:..:.:..:.:...||.|.|..||...:     :.|::| .||.|   .|...:.|. .|.
Human    28 GTSASEALYVTDNDEVFVFGLNYSNCLGTGDN-----QSTLVPKKLEGLCGKKIKSLSYGSGPHV 87

  Fly   182 LFLTDTGTVYACGENKSGQCGVGNTHANIYSPTPI--NYRGPPIIRIGCGAEFSVILDIKGSLHT 244
            |..|:.|.|||.|.|...|.|.|.|:..| :|..:  |.....::.:.||:..|:.|...|.:..
Human    88 LLSTEDGVVYAWGHNGYSQLGNGTTNQGI-APVQVCTNLLIKQVVEVACGSHHSMALAADGEVFA 151

  Fly   245 FGLPEYGQLGHNTDAKYFVNANKLSFHFETSPKKVV--LYIEKSKEGHVTPVDGVQIVDFACGNN 307
            :|....||:|..:.|.            :.:|:||.  |:|::             :|..|||..
Human   152 WGYNNCGQVGSGSTAN------------QPTPRKVTNCLHIKR-------------VVGIACGQT 191

  Fly   308 HTVAIDSKKRVYSWGFGGFGRLGHAEPKDEMVPRLMKFFDTQGRGGRSVFCGSTFSLIVNELGLL 372
            .::|:.....||.||:.|.|:||.....:::.|  ::...........:.||...:|.:.:.|||
Human   192 SSMAVLDNGEVYGWGYNGNGQLGLGNNGNQLTP--VRVAALHSVCVNQIVCGYAHTLALTDEGLL 254

  Fly   373 FLFGQNKKTGEANMYPKPVQDLSGWNITDIGCANTSIMISADDTLIAWGASPTFGELGIGEFQKS 437
            :                                             ||||: |:|:||.|     
Human   255 Y---------------------------------------------AWGAN-TYGQLGTG----- 268

  Fly   438 STVPKEVPKLDNIKIPQVTMGYSHTVLLVDTTHEA 472
                    ..:|:..|...|.....|:.:...|.|
Human   269 --------NKNNLLSPAHIMVEKERVVEIAACHSA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 15/49 (31%)
RCC1_2 171..200 CDD:290274 11/29 (38%)
RCC1 188..236 CDD:278826 16/49 (33%)
RCC1 239..312 CDD:278826 15/74 (20%)
RCC1 317..366 CDD:278826 12/48 (25%)
RCC1 414..465 CDD:278826 13/50 (26%)
RCBTB1NP_001339429.1 RCC1 1 40..91 15/55 (27%)
ATS1 43..>316 CDD:227511 79/345 (23%)
RCC1 2 93..145 17/52 (33%)
RCC1 3 147..198 16/75 (21%)
RCC1 4 199..250 12/52 (23%)
RCC1 5 252..302 18/103 (17%)
RCC1 6 304..356
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662
BACK_RCBTB1 466..531 CDD:350603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.