DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and HERC6

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_005263140.1 Gene:HERC6 / 55008 HGNCID:26072 Length:1034 Species:Homo sapiens


Alignment Length:337 Identity:88/337 - (26%)
Similarity:135/337 - (40%) Gaps:81/337 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 IVQAAVGRHHTLFLTDTGTVYACGENKSGQCG------------VGNTHANIYSPTPINYRGPPI 223
            ::|||.|..|:|.|.....|.:||:|..||.|            ||.... ::...||......|
Human    25 LLQAASGERHSLLLLTNHRVLSCGDNSRGQLGRRGAQRGELPVVVGGCFV-LFPKEPIQALETLI 88

  Fly   224 I-RIGCGAEFSVILDIKGSLHTFGLPEYGQLGHNTDAKYFVNANKLSFHFETSPKKVVLYIEKSK 287
            : .:.||.|.|:.:..||.:..:|....||||       .....::||    :|||::       
Human    89 VDLVSCGKEHSLAVCHKGRVFAWGAGSEGQLG-------IGEFKEISF----TPKKIM------- 135

  Fly   288 EGHVTPVDGVQIVDFACGNNHTVAIDSKKRVYSWGFGGFGRLGHAEPKDEMVPRLMKFFDTQ--- 349
                 .::.::|:..:||:.|::|:....:|:|||....|:||           |.|.|.:|   
Human   136 -----TLNDIKIIQVSCGHYHSLALSKDSQVFSWGKNSHGQLG-----------LGKEFPSQASP 184

  Fly   350 --------------GRGGRSVF----CGSTFSLIVNELGLLFLFGQNKKTGEANMYPKPVQDLSG 396
                          ..||...|    ||::|....|..|.|.|.|:|... ::|. |..|..|..
Human   185 QRVRSLEGIPLAQVAAGGAHSFALSLCGTSFGWGSNSAGQLALSGRNVPV-QSNK-PLSVGALKN 247

  Fly   397 WNITDIGCANTSIMISADDTLIAWGASPTFGELGIGEFQKSSTVPKEVPKL----DNIKIPQVTM 457
            ..:..|.|.:....:...|     |...|||:...|:...|.|..|..|:|    |.: :.|:..
Human   248 LGVVYISCGDAHTAVLTQD-----GKVFTFGDNRSGQLGYSPTPEKRGPQLVERIDGL-VSQIDC 306

  Fly   458 GYSHTVLLVDTT 469
            |..||:..|.||
Human   307 GSYHTLAYVHTT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 6/12 (50%)
RCC1_2 171..200 CDD:290274 11/28 (39%)
RCC1 188..236 CDD:278826 16/60 (27%)
RCC1 239..312 CDD:278826 16/72 (22%)
RCC1 317..366 CDD:278826 17/69 (25%)
RCC1 414..465 CDD:278826 16/54 (30%)
HERC6XP_005263140.1 RCC1_2 27..54 CDD:290274 11/26 (42%)
RCC1_2 89..118 CDD:290274 7/28 (25%)
RCC1 105..155 CDD:278826 16/72 (22%)
RCC1 158..208 CDD:278826 14/60 (23%)
RCC1 215..263 CDD:278826 13/49 (27%)
RCC1_2 250..279 CDD:290274 7/33 (21%)
RCC1 266..313 CDD:278826 16/52 (31%)
HECTc 684..1026 CDD:238033
HECTc 711..1026 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.