DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and CG6678

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster


Alignment Length:293 Identity:68/293 - (23%)
Similarity:112/293 - (38%) Gaps:77/293 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DDG------------VQQQAAAANQMEVLIPHDDL---DPPSKLPEDLLAT-LE----------- 73
            |||            ::..|||.:...||:....|   .|  ||..:|:|. ||           
  Fly    64 DDGPNECVTLEATGNIRALAAADSHCLVLLQSGQLYRVQP--KLQAELVAVRLEAAPRSNSGTKR 126

  Fly    74 ------KTPGQMLIAGMVTWDLTGKRDRKNVTKVRPN-LYS----FHRFTEEKYRYVASGPSAAH 127
                  |.|...:|..:..      ....||.....| :||    .|:|:|.::|.........|
  Fly   127 SIFGAAKAPSSPIIEHIAC------GSHINVAISSENCVYSIPSCLHQFSERQFRVKQLQCGHEH 185

  Fly   128 TILINMDRKALGFGRNPSGQLGLSQDIKLAEKPTIIPALEQLNIVQAAVGRHHTLFLTDTGTVYA 192
            .:|:|.:.....:|....|||||: ::::.|.|.::.||..:.|.|.|.|..|:..::..|.:|.
  Fly   186 AVLLNANGDVFTWGNGLRGQLGLA-ELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYT 249

  Fly   193 CGENKSGQCGVGNTHANIYSP-----TPINYRGPPI--------------------IRIGCGAEF 232
            .|.|.|||.|:     .:..|     .|..:..|.:                    :|:..|:..
  Fly   250 WGLNCSGQLGL-----RVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSRH 309

  Fly   233 SVILDIKGSLHTFGLPEYGQLGHNTDAKYFVNA 265
            ::::...|.|...|..::||||.......:|:|
  Fly   310 TLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 15/44 (34%)
RCC1_2 171..200 CDD:290274 10/28 (36%)
RCC1 188..236 CDD:278826 13/72 (18%)
RCC1 239..312 CDD:278826 9/27 (33%)
RCC1 317..366 CDD:278826
RCC1 414..465 CDD:278826
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 65/279 (23%)
RCC1_2 176..205 CDD:290274 4/28 (14%)
RCC1 192..241 CDD:278826 15/49 (31%)
RCC1_2 228..257 CDD:290274 10/28 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442601
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.