DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and CG8060

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster


Alignment Length:216 Identity:56/216 - (25%)
Similarity:92/216 - (42%) Gaps:35/216 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LGFGRNPSGQLGLSQDIKLAEKPTIIPALEQLN--IVQAAVGRHHTLFLTDTGTVYACGENKSGQ 200
            |.:|.|.:..||:..: :....|..:....:.|  :.|.|:|.:|:||....|.:||.|..|.|:
  Fly   149 LVWGSNKNYNLGIGNE-QNTNTPQAVDFFRKSNLWLEQVALGAYHSLFCDKKGHLYAVGHGKGGR 212

  Fly   201 CGVGNTHANIYSPTPINYR------GPPIIRIGCGAEFSVILDIKGSLHTFGLPEYGQLGHNTDA 259
            .|:|..::   .|.|...:      |..|..|....:.|::|..:..:...||....|||....|
  Fly   213 LGIGLENS---LPAPKRVKVSSKLSGDSIQCISVSRQHSLVLTHQSLVFACGLNTDHQLGVRDAA 274

  Fly   260 KYFVNANKLSFHFETSPKKVVLYIEKSKEGHVTPVDGVQIVDFACGNNHTVAIDSKKRVYSWGFG 324
            :..           |..|:||...:|...      |.|:::  || :.|::|..| :.||.|| .
  Fly   275 EQL-----------TQFKEVVALRDKGAS------DLVRVI--AC-DQHSIAYGS-RCVYVWG-A 317

  Fly   325 GFGRLG-HAEPKDEMVPRLMK 344
            ..|:.| ::......||.|:|
  Fly   318 NQGQFGINSNTPSITVPTLIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 11/46 (24%)
RCC1_2 171..200 CDD:290274 11/28 (39%)
RCC1 188..236 CDD:278826 14/53 (26%)
RCC1 239..312 CDD:278826 16/72 (22%)
RCC1 317..366 CDD:278826 10/29 (34%)
RCC1 414..465 CDD:278826
CG8060NP_611117.2 ANK <46..138 CDD:238125
ANK repeat 56..87 CDD:293786
Ank_4 57..111 CDD:290365
ANK repeat 89..121 CDD:293786
Ank_2 95..>138 CDD:289560
RCC1 147..195 CDD:278826 11/46 (24%)
RCC1 199..251 CDD:278826 14/54 (26%)
BTB 547..>635 CDD:295341
BTB 684..795 CDD:279045
BTB 697..798 CDD:197585
SPOP_C_like 798..>834 CDD:269810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.